BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0839 (538 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 2.6 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 3.5 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 8.0 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 8.0 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.6 bits (46), Expect = 2.6 Identities = 11/48 (22%), Positives = 20/48 (41%) Frame = -2 Query: 462 CLFICSLLYICSGFQ*TMKAVLRKPLYPKRTARDFRPRGHCIRTPCGY 319 C+F+ +++I SG + V+ ++ RPR P Y Sbjct: 178 CVFVAGVVFIVSGLLMLVGMVMYISVFKAEVGSKLRPRSSFQGPPFTY 225 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 393 KPLYPKRTARDFRPRGHCIRTPCGYPR 313 +P+ P + ++ PR CI P +PR Sbjct: 133 RPMGPWISVQEQVPRFRCIGPPTPFPR 159 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.0 bits (42), Expect = 8.0 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +1 Query: 106 KIVNTQRNQYL 138 ++ NTQRN+YL Sbjct: 366 RVNNTQRNEYL 376 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.0 bits (42), Expect = 8.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 304 QPTPGVTAWRSDT 342 QP G+ W+SDT Sbjct: 215 QPGEGLPMWKSDT 227 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,950 Number of Sequences: 438 Number of extensions: 3413 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -