SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0839
         (538 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    23   2.6  
DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex det...    22   3.5  
Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    21   8.0  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       21   8.0  

>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 22.6 bits (46), Expect = 2.6
 Identities = 11/48 (22%), Positives = 20/48 (41%)
 Frame = -2

Query: 462 CLFICSLLYICSGFQ*TMKAVLRKPLYPKRTARDFRPRGHCIRTPCGY 319
           C+F+  +++I SG    +  V+   ++        RPR      P  Y
Sbjct: 178 CVFVAGVVFIVSGLLMLVGMVMYISVFKAEVGSKLRPRSSFQGPPFTY 225


>DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 9/27 (33%), Positives = 15/27 (55%)
 Frame = -2

Query: 393 KPLYPKRTARDFRPRGHCIRTPCGYPR 313
           +P+ P  + ++  PR  CI  P  +PR
Sbjct: 133 RPMGPWISVQEQVPRFRCIGPPTPFPR 159


>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 21.0 bits (42), Expect = 8.0
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +1

Query: 106 KIVNTQRNQYL 138
           ++ NTQRN+YL
Sbjct: 366 RVNNTQRNEYL 376


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.0 bits (42), Expect = 8.0
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 304 QPTPGVTAWRSDT 342
           QP  G+  W+SDT
Sbjct: 215 QPGEGLPMWKSDT 227


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 144,950
Number of Sequences: 438
Number of extensions: 3413
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15213684
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -