BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0837 (537 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0630 - 5470869-5471429 28 4.1 03_02_0770 + 11038971-11039392,11040071-11040353,11040697-11040798 28 5.4 >08_01_0630 - 5470869-5471429 Length = 186 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 6 NFHNP-PAPYFPVNRAKDTNGHARSKEGEGRYKG 104 N H P P P P + T+G R++ G GR +G Sbjct: 49 NPHKPQPHPTIPSSTTTTTSGRRRNRRGRGRGRG 82 >03_02_0770 + 11038971-11039392,11040071-11040353,11040697-11040798 Length = 268 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 4/27 (14%) Frame = -1 Query: 525 PQW----KLSRLVAPNAXRSLSKNCIP 457 P W KLSR++ PN R +S C+P Sbjct: 146 PSWGLSQKLSRVIGPNRAREVSLTCMP 172 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,261,933 Number of Sequences: 37544 Number of extensions: 161055 Number of successful extensions: 349 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -