BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0837 (537 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL049766-4|CAC33877.1| 1918|Homo sapiens zinc finger, NFX1-type ... 30 4.5 AK023836-1|BAB14696.1| 1137|Homo sapiens protein ( Homo sapiens ... 30 4.5 AB037825-1|BAA92642.1| 1925|Homo sapiens KIAA1404 protein protein. 30 4.5 >AL049766-4|CAC33877.1| 1918|Homo sapiens zinc finger, NFX1-type containing 1 protein. Length = 1918 Score = 30.3 bits (65), Expect = 4.5 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -2 Query: 353 RLGCGNTNSXSCKXXSSTAHKRICCRLPCLSRHCLPHH 240 RLGCG+ + +C S +HK C PC C H Sbjct: 1295 RLGCGHVCTRACHPYDS-SHKEFQCMKPCQKVICQEGH 1331 >AK023836-1|BAB14696.1| 1137|Homo sapiens protein ( Homo sapiens cDNA FLJ13774 fis, clone PLACE4000326, weakly similar to NAM7 PROTEIN (NONSENSE-MEDIATED MRNA DECAY PROTEIN 1). ). Length = 1137 Score = 30.3 bits (65), Expect = 4.5 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -2 Query: 353 RLGCGNTNSXSCKXXSSTAHKRICCRLPCLSRHCLPHH 240 RLGCG+ + +C S +HK C PC C H Sbjct: 587 RLGCGHVCTRACHPYDS-SHKEFQCMKPCQKVICQEGH 623 >AB037825-1|BAA92642.1| 1925|Homo sapiens KIAA1404 protein protein. Length = 1925 Score = 30.3 bits (65), Expect = 4.5 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -2 Query: 353 RLGCGNTNSXSCKXXSSTAHKRICCRLPCLSRHCLPHH 240 RLGCG+ + +C S +HK C PC C H Sbjct: 1302 RLGCGHVCTRACHPYDS-SHKEFQCMKPCQKVICQEGH 1338 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,585,755 Number of Sequences: 237096 Number of extensions: 857493 Number of successful extensions: 1684 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1684 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5273648886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -