BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0836 (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.71 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 1.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 1.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.2 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 6.6 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 6.6 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 21 8.7 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 0.71 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 78 TATPPPSKVAPQCGKPANAAPTKRYL 155 T PPP+ V P+ KP+ +Y+ Sbjct: 1084 TTIPPPAVVMPEVDKPSQPCEPGQYV 1109 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -1 Query: 528 VQIMTRRVGYMSQWVESSSRICFVAGL*RGNSRVRNRQYF 409 V ++ VG+ +V +S + F+ L + + R YF Sbjct: 15 VSVILISVGWWENFVSETSYLPFIRALGKSKKEFKTRTYF 54 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 90 PPSKVAPQCGKPANAAPTKRYLLSIGRIFH 179 P + +A QC K +N +P ++G+ FH Sbjct: 36 PLAMLAAQCNKLSNKSPPPLADAAVGKGFH 65 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -1 Query: 528 VQIMTRRVGYMSQWVESSSRICFVAGL*RGNSRVRNRQYF 409 V ++ VG+ +V +S + F+ L + + R YF Sbjct: 248 VSVILISVGWWENFVSETSYLPFIRALGKSKKEFKTRTYF 287 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -1 Query: 528 VQIMTRRVGYMSQWVESSSRICFVAGL*RGNSRVRNRQYF 409 V ++ VG+ +V +S + F+ L + + R YF Sbjct: 248 VSVILISVGWWENFVSETSYLPFIRALGKSKKEFKTRTYF 287 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 256 LPLSFPRTEPRHVRGVV 306 L FP T+P+ +RG + Sbjct: 145 LAWEFPETKPKKIRGKI 161 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +1 Query: 91 HHPKWPHSAGNQPTQHP 141 HH +W +S N Q+P Sbjct: 72 HHGQWNYSPDNHFEQYP 88 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 188 RKFVEDPPNREQITLGGCCVGW 123 RK ++DP R Q+ + VGW Sbjct: 264 RKNLKDPCRRRQMYVDFGSVGW 285 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 80 GDSPTIQSGPTVRE 121 GD T+Q GPTV + Sbjct: 1438 GDWETVQIGPTVEK 1451 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,730 Number of Sequences: 336 Number of extensions: 3924 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -