BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0836 (645 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual 49 7e-07 SPBC11B10.06 |sws1||SWIM domain containing-Srs2 interacting prot... 30 0.25 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 30 0.33 SPBC725.08 |||transcription factor |Schizosaccharomyces pombe|ch... 27 3.1 SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces p... 25 9.3 SPAC1039.09 |isp5||amino acid permease Isp5|Schizosaccharomyces ... 25 9.3 >SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 1496 Score = 48.8 bits (111), Expect = 7e-07 Identities = 25/68 (36%), Positives = 36/68 (52%) Frame = +2 Query: 257 YRYRFHAPNHDTYEVSWVSFTTEKLETYYWNYMDHYICTRGDSDFALVEPLKYWRFRTLL 436 Y Y F + N Y S ++F+ Y WNY+D IC G + L + +KYWR R +L Sbjct: 943 YDYNFWSKNECKYVKSNITFSANDSANYNWNYVDQLIC--GFETY-LPDSVKYWRARFVL 999 Query: 437 LPLYNPAT 460 LP+ +T Sbjct: 1000 LPMSTTST 1007 >SPBC11B10.06 |sws1||SWIM domain containing-Srs2 interacting protein 1|Schizosaccharomyces pombe|chr 2|||Manual Length = 209 Score = 30.3 bits (65), Expect = 0.25 Identities = 15/56 (26%), Positives = 23/56 (41%) Frame = -2 Query: 269 NDNGSYIEWRIWMSGSVSSDGDGRPDQRKFVEDPPNREQITLGGCCVGWFPALWGH 102 ++N + I+ + W + R F E P EQ T GG C+ P + H Sbjct: 139 SNNKTTIDLKYWYCSCSQFSYNAFNSSRSFDEPMPKNEQETWGGRCLSHHPTICSH 194 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 29.9 bits (64), Expect = 0.33 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = +3 Query: 75 STATPPPSKVAPQCGKPANAAPTKRYLLSIGRIFHKLTLVGSTITVTRYRPRHPYP 242 ST PPP + PA A+P +G +H T G+ + + +P HP P Sbjct: 905 STLPPPPPTASMTASAPAIASPPPP---KVGETYHPPTASGTRVPPVQ-QPSHPNP 956 >SPBC725.08 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 609 Score = 26.6 bits (56), Expect = 3.1 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 427 DSTIASLQSGNETNSRRRLNPLRHISNSTRHDLDQLTDNFLKMTE 561 +S IA LQ SR++ NP + + L L +NF + E Sbjct: 396 ESLIALLQDSPAGYSRKKFNPSKEVGQEENIWLSDLENNFACLLE 440 >SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 25.0 bits (52), Expect = 9.3 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +2 Query: 428 TLLLPLYNPATKQILEDDSTHCDIYPTRRVMIWTN*PIISSK*PNCISIKSKG 586 T +L L+N T + D + DIY + + P+I K P I ++ G Sbjct: 417 TRVLQLHNLITGDEIMDVQEYEDIYESVKTQFSNYGPLIDIKIPRSIGTRNSG 469 >SPAC1039.09 |isp5||amino acid permease Isp5|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 133 ALAGFPHCGATLDGGGVAVD 74 A+ GF CG +D GGV D Sbjct: 231 AMVGFIICGIVIDCGGVRTD 250 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,903,130 Number of Sequences: 5004 Number of extensions: 63763 Number of successful extensions: 180 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -