BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0836 (645 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 24 1.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 1.9 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 23 3.3 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 3.3 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.4 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 7.7 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 7.7 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.7 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 23.8 bits (49), Expect = 1.4 Identities = 17/68 (25%), Positives = 30/68 (44%) Frame = +3 Query: 36 GVNENEVIESHCASTATPPPSKVAPQCGKPANAAPTKRYLLSIGRIFHKLTLVGSTITVT 215 G+N+ + + HC+ P P ++ + + A P LLS G + + V +TI T Sbjct: 32 GMNQCQAVNGHCSHLCLPAP-RINSKSPLLSCACPDGLKLLSDGLMC--VEKVSTTIVPT 88 Query: 216 RYRPRHPY 239 P+ Sbjct: 89 TQEINKPF 96 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/32 (28%), Positives = 13/32 (40%) Frame = +1 Query: 109 HSAGNQPTQHPPSVICSRLGGSSTNLRWSGLP 204 H+A P Q P C+ L + + W P Sbjct: 1075 HTAEGVPEQPPHDTTCTTLTSQTIRISWMSPP 1106 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 22.6 bits (46), Expect = 3.3 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +3 Query: 36 GVNENEVIESHCASTATPPPSKVAPQCGKPANAAPTKRYLLSIG 167 G+N+ + + HC+ P P ++ + + A P LLS G Sbjct: 32 GMNQCQAVNGHCSHLCLPAP-RINSKSPLLSCACPDGLKLLSDG 74 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 323 EKLETYYWNYMDHYICTRG 379 EKL T YW ++ +C G Sbjct: 372 EKLSTIYWFTVEFGLCKEG 390 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 72 ASTATPPPSKVAPQCGKPA 128 +ST++ PP+K A G+P+ Sbjct: 523 SSTSSSPPAKGAAAAGQPS 541 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 465 KFSKTTQPTATYIQLDAS*FGPTNR*FP 548 + + QP YIQL G T+ FP Sbjct: 292 RMQQVEQPVQVYIQLKRPSDGATSEPFP 319 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 465 KFSKTTQPTATYIQLDAS*FGPTNR*FP 548 + + QP YIQL G T+ FP Sbjct: 292 RMQQVEQPVQVYIQLKRPSDGATSEPFP 319 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 33 VGVNENEVIESHCASTATPPPSKV 104 V V N+ + HC + P P+ V Sbjct: 719 VSVERNKHVALHCQAQGVPTPTIV 742 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 33 VGVNENEVIESHCASTATPPPSKV 104 V V N+ + HC + P P+ V Sbjct: 715 VSVERNKHVALHCQAQGVPTPTIV 738 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,207 Number of Sequences: 438 Number of extensions: 4529 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -