BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0833 (603 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 4.6 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 2.6 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +2 Query: 491 ECEHNKDKLKHQMSVHSPP 547 E ++ +D + HQ+ V++PP Sbjct: 1379 ENDYGQDSVTHQLIVNAPP 1397 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 4.6 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = -3 Query: 529 HLVLQFVLIVFTFSPLHASAYTFSIFCSEQVRYYF*FLYI 410 HL+ I+FT L + Y + F YYF + +I Sbjct: 82 HLLFYCPFIIFTVHFLLCTYYFYYAFIILLCVYYFYYAFI 121 Score = 21.4 bits (43), Expect = 6.1 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = -1 Query: 255 LLCAPLLFWHVHFYLKLCI 199 L C +F+++H LC+ Sbjct: 181 LFCCAFIFFNMHLLFLLCL 199 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,799 Number of Sequences: 336 Number of extensions: 2997 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -