BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0832 (508 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 28 0.064 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 1.4 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 3.2 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 5.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.6 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 27.9 bits (59), Expect = 0.064 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 214 LRRPRSLYSTVSRS*FEPAEAHRDSGEEPASGQR 315 LRR R L +TV+R+ H DSG ++ QR Sbjct: 248 LRRSRMLTATVNRNHLSGGTNHWDSGRRKSAAQR 281 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 69 SVSDTPSLKDLPKVATDLKS 128 SVS PS+K + K ATD S Sbjct: 156 SVSCVPSVKHVAKCATDFSS 175 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.2 bits (45), Expect = 3.2 Identities = 16/62 (25%), Positives = 29/62 (46%) Frame = +2 Query: 224 PEVFIRRYREVDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTXLKHTETX 403 P+V +RY++V+ SQ+ + K+ + + K K+ + IEN T + T Sbjct: 181 PDVEEQRYKQVEISQMTEPSSSTKSYVLEGPRNGKRKRKS---STIENESETESNASSTK 237 Query: 404 EK 409 K Sbjct: 238 TK 239 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = +3 Query: 117 DLKSQLEGFNTSCLRDVDTNEKIV 188 +LKS L + C++++ T ++I+ Sbjct: 21 ELKSGLHTVQSVCMKEIGTAQQII 44 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 5.6 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 353 NGIENFDPTXLKHTETXEKNPLL 421 NGI DP+ + +T T P++ Sbjct: 1441 NGIGTGDPSDMLNTRTKGSKPII 1463 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,707 Number of Sequences: 438 Number of extensions: 2419 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -