BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0831 (687 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 4.8 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 4.8 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 21 8.3 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 8.3 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/35 (28%), Positives = 14/35 (40%) Frame = -3 Query: 142 IVHQPIQTSCTLCCVDFRQPLNNIT*YFKTCSPGD 38 I+ + T C C + N + Y KT P D Sbjct: 63 ILPDALSTGCNKCNEKQKHTANKVVNYLKTKRPKD 97 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/35 (28%), Positives = 14/35 (40%) Frame = -3 Query: 142 IVHQPIQTSCTLCCVDFRQPLNNIT*YFKTCSPGD 38 I+ + T C C + N + Y KT P D Sbjct: 63 ILPDALSTGCNKCNEKQKHTANKVVNYLKTKRPKD 97 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 147 VPSYISPYKHP 115 VP ++SPY HP Sbjct: 75 VPYHMSPYGHP 85 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 467 LCYPCDVKLPLLELKFTAK 523 +CY CDV L K T K Sbjct: 370 VCYTCDVCGKTLSTKLTLK 388 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,914 Number of Sequences: 438 Number of extensions: 3833 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -