BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0827 (562 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 28 0.063 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 7.2 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 27.9 bits (59), Expect = 0.063 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 331 YLLTYCL*IIFSK*MLKLKIFFFYFRYILICNRY 432 +LL YC IIF+ L +F+Y IL+C Y Sbjct: 82 HLLFYCPFIIFTVHFLLCTYYFYYAFIILLCVYY 115 Score = 24.2 bits (50), Expect = 0.78 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +1 Query: 307 ILISNILPYLLTYCL*IIFSK*MLKLKIFFFYFRYILICNRYV 435 +LI + Y Y + +L + I++FY+ ++L C ++ Sbjct: 231 VLIILLCIYYFYYAFILFTVHLLLLVCIYYFYYMHLLFCCAFI 273 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.0 bits (42), Expect = 7.2 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 147 LLPKIK*KQREITNLYRTSNLGKIRVSIIICGT 245 ++PK+ R+ LYR + L I V CG+ Sbjct: 484 IIPKVLAMSRDQNYLYRMTCLFCINVLAEACGS 516 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,859 Number of Sequences: 336 Number of extensions: 2325 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -