BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0827 (562 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24630.1 68417.m03527 zinc finger (DHHC type) family protein ... 34 0.075 At3g61130.1 68416.m06841 glycosyl transferase family 8 protein c... 27 8.6 >At4g24630.1 68417.m03527 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 374 Score = 33.9 bits (74), Expect = 0.075 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 95 IYTY*PFWFV--LCLIHVYFITKNQIKTTRNN 184 IY + WFV L H+Y I+ NQ+K +RNN Sbjct: 229 IYCFIALWFVGGLTAFHLYLISTNQVKPSRNN 260 >At3g61130.1 68416.m06841 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 673 Score = 27.1 bits (57), Expect = 8.6 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +1 Query: 31 IKVKRFSDF-SRLAIQRVKSKFDLYILTVLVCAVLDTRVFYYQKSNKNN 174 + VK+ D+ RLA+Q V+S F IL V+ + D KNN Sbjct: 55 VSVKQNLDWRERLAMQSVRSLFSKEILDVIATSTADLGPLSLDSFKKNN 103 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,430,262 Number of Sequences: 28952 Number of extensions: 161008 Number of successful extensions: 240 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 240 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -