BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0826 (447 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25417| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_13911| Best HMM Match : PAN (HMM E-Value=0.033) 27 9.3 >SB_25417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 27.9 bits (59), Expect = 4.0 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 441 SGENIIENXQFAGKXSLNDTSSKNSNXXFPKLPELTKDAV*IERVRQLRLHHFVSGCRPV 262 S + I ++ Q GK S + +N + E+ + +ERV + HH+ SG RP Sbjct: 176 SDKCITDDYQKCGKFSRFCVGEQWTNFVY----EIVRPTCRVERVGCFKDHHY-SGARPF 230 Query: 261 SPYVQS 244 YVQ+ Sbjct: 231 PEYVQT 236 >SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3292 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 269 VPFHLMCSHCSPSYVFALRLIALSLQNEIL 180 VP L CSHC P V L+ + Q EIL Sbjct: 2711 VPLSLCCSHCIPGPVHIFVLLPIR-QKEIL 2739 >SB_13911| Best HMM Match : PAN (HMM E-Value=0.033) Length = 534 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 57 IEHSCCSDTSSIRFY*LCSTKLNNV 131 I H +D+S +RFY + + KLN V Sbjct: 392 ITHFLSNDSSKVRFYKIYNNKLNRV 416 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,036,843 Number of Sequences: 59808 Number of extensions: 155952 Number of successful extensions: 376 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -