BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0824 (503 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g61140.1 68416.m06842 COP9 signalosome complex subunit 1 / CS... 46 2e-05 At1g30590.1 68414.m03742 RNA polymerase I specific transcription... 27 7.2 >At3g61140.1 68416.m06842 COP9 signalosome complex subunit 1 / CSN complex subunit 1 (CSN1) / COP11 protein (COP11) / FUSCA protein (FUS6) FUSCA6, COP11, CSN1; identical to FUS6 GI:432446, SP:P45432 from [Arabidopsis thaliana]; contains Pfam profile PF01399: PCI domain; identical to cDNA CSN complex subunit 1 (CSN1) GI:18056652 Length = 441 Score = 45.6 bits (103), Expect = 2e-05 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 3/73 (4%) Frame = +1 Query: 250 LGLETYAASYTGFAKLYRLMFVADHC---PSLRLEALKMAISYVMTTYNVNLYHTLHKKL 420 L +E YAA Y G K+ RL+F+A+HC +L+ +AL+MA + N L+ + K+ Sbjct: 34 LDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVNKI 93 Query: 421 SEAVASAGLPDIA 459 + D+A Sbjct: 94 GNRLGEKYGMDLA 106 >At1g30590.1 68414.m03742 RNA polymerase I specific transcription initiation factor RRN3 family protein weak similarity to RNA polymerase I transcription factor RRN3 [Homo sapiens] GI:7670100; contains Pfam profile PF05327: RNA polymerase I specific transcription initiation factor RRN3 Length = 604 Score = 27.1 bits (57), Expect = 7.2 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 3/61 (4%) Frame = -3 Query: 417 FFMQCVIQIYVICGHDIGYGHFQSFQSQ*R---TVVCYKHEPIKFCKTSI*RSVCFQTKV 247 F+ C +YV+C FQSQ R +++ +K P+ C S+ Q K Sbjct: 412 FYSGCQAILYVLCFRMRSIVEIPRFQSQFRSLESILSHKLNPLLVCLPSVVSEFLKQAKA 471 Query: 246 G 244 G Sbjct: 472 G 472 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,067,136 Number of Sequences: 28952 Number of extensions: 233768 Number of successful extensions: 538 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 898188928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -