BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0821 (609 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 29 0.036 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 29 0.036 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 24 1.0 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 7.1 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 9.4 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 29.1 bits (62), Expect = 0.036 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -1 Query: 312 LVTFFCKCKIIFNQSVVVSGCT*FLS*TSKLKTRRSCQSITQFMFK 175 L T+F KC + N +V V + +LK RR+C + +F +K Sbjct: 461 LYTYFDKCDTLINNAVAVENFKGGM--YLRLKARRACMNYERFTYK 504 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 29.1 bits (62), Expect = 0.036 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -1 Query: 312 LVTFFCKCKIIFNQSVVVSGCT*FLS*TSKLKTRRSCQSITQFMFK 175 L T+F KC + N +V V + +LK RR+C + +F +K Sbjct: 461 LYTYFDKCDTLINNAVAVENFKGGM--YLRLKARRACMNYERFTYK 504 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 24.2 bits (50), Expect = 1.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 385 NGDXFDLRANFSVC 344 NGD +DL+ N VC Sbjct: 426 NGDQYDLKKNLKVC 439 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +1 Query: 55 IISNVPNHFVSRSRTSSLNYTFVKHYENSN 144 IIS++ N + + NY +Y N+N Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNKYNYNNNN 110 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.0 bits (42), Expect = 9.4 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -3 Query: 556 VFVESVHHARK*VHRLXPW 500 + + +VH+ + H++ PW Sbjct: 317 IVILNVHYRKPSTHKMAPW 335 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,261 Number of Sequences: 438 Number of extensions: 2338 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -