BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0819 (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB2B2.01 |||amino acid permease, unknown 12|Schizosaccharomyc... 31 0.073 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 29 0.39 SPBC8D2.10c |rmt3|rmt3|type I ribosomal protein arginine N-methy... 27 1.6 SPAC31G5.16c |dpm1||dolichol-phosphate mannosyltransferase catal... 27 1.6 SPAC6F12.11c |sfc1||transcription factor TFIIIC complex A box as... 26 3.6 SPBC20F10.05 |||DuF1740 family protein|Schizosaccharomyces pombe... 25 6.3 >SPBPB2B2.01 |||amino acid permease, unknown 12|Schizosaccharomyces pombe|chr 2|||Manual Length = 585 Score = 31.5 bits (68), Expect = 0.073 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +3 Query: 309 LVLIFMISVFGVKNNGNIVFVIMLTLLQXLCG-MCFGFVI 425 +V +F I++FGVK G + F++ + +CG + G +I Sbjct: 203 IVFLFFINIFGVKGYGEMEFIMSTIKVVAMCGFIILGIII 242 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 29.1 bits (62), Expect = 0.39 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 431 GRYHEPEAHAAQTLQQSQHDNEDDVPIILDAEHRYHE-DEHQRRLSAHH 288 G++H+ + HA ++S EDD D ++HE D+ R AHH Sbjct: 154 GKHHKGK-HAKGKGKKSHPKPEDDSVFFDDERPKHHEFDDEDREFPAHH 201 >SPBC8D2.10c |rmt3|rmt3|type I ribosomal protein arginine N-methytransferase Rmt3|Schizosaccharomyces pombe|chr 2|||Manual Length = 543 Score = 27.1 bits (57), Expect = 1.6 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 28 LLETCDYNPKLGDIPIDFMDPIYGNKNPSFTDFVAPGVILTIV 156 L+ T N +L + PIDF +YG K D GV + +V Sbjct: 365 LVLTATTNTELLEEPIDFWSDVYGFKMNGMKDASYKGVSVQVV 407 >SPAC31G5.16c |dpm1||dolichol-phosphate mannosyltransferase catalytic subunit Dpm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 236 Score = 27.1 bits (57), Expect = 1.6 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 43 DYNPKLGDIPIDFMDPIYGNKNPSFTDFV 129 ++N +G++PI F+D +YG D + Sbjct: 196 EHNYTIGEVPIAFVDRLYGESKLGMDDIL 224 >SPAC6F12.11c |sfc1||transcription factor TFIIIC complex A box associated subunit Sfc1|Schizosaccharomyces pombe|chr 1|||Manual Length = 456 Score = 25.8 bits (54), Expect = 3.6 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Frame = +3 Query: 108 PFVHRLRSSRRHINHRILPRRGPDIVSVDRGTDGGXPGPILGXRSVSRXILFXQ--VVNQ 281 PFV +L S+ R +++ + + D+ V R P P+ S+ F Q +V + Sbjct: 113 PFVQKLDSTLRVLDYNAINKFSIDLTPVQRKHVDMPPPPVFSQTSLPMSYNFLQNPLVGR 172 Query: 282 FVVMCGQTALV 314 + G+T +V Sbjct: 173 VRLPNGKTTIV 183 >SPBC20F10.05 |||DuF1740 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 972 Score = 25.0 bits (52), Expect = 6.3 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = -3 Query: 263 EQDXPGDTPATQNRSRXPSIRSTINADDVRATARKNTMVNMTPGATK 123 E G P NR+ PS +ST + + ++A + + PG + Sbjct: 134 EDGQQGFIPLLVNRNSDPSEKSTFSLNILKAIKETDEEIKKNPGKAR 180 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,930,802 Number of Sequences: 5004 Number of extensions: 37357 Number of successful extensions: 118 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -