BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0819 (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.4 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 1.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 251 PGDTPATQNRSRXPSIRSTINADDV 177 PG+ P TQ R P +T +++ Sbjct: 400 PGENPVTQKREGGPPTGATTGPNEI 424 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 1.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 251 PGDTPATQNRSRXPSIRSTINADDV 177 PG+ P TQ R P +T +++ Sbjct: 420 PGENPVTQKREGGPPTGATTGPNEI 444 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 1.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 251 PGDTPATQNRSRXPSIRSTINADDV 177 PG+ P TQ R P +T +++ Sbjct: 369 PGENPVTQKREGGPPTGATTGPNEI 393 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 20.6 bits (41), Expect = 9.4 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 407 HAAQTLQQSQHDNEDDVPIILDAEHRYHED 318 H QT + + + L E+RYHED Sbjct: 1087 HIIQTHGEMTDKQVEAYMLSLRDENRYHED 1116 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,635 Number of Sequences: 438 Number of extensions: 2862 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -