BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0818 (587 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 95 1e-21 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 95 1e-21 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 95 1e-21 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 95 1e-21 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 26 1.0 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 5.5 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 7.3 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 7.3 EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. 23 9.7 EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. 23 9.7 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 95.5 bits (227), Expect = 1e-21 Identities = 47/60 (78%), Positives = 49/60 (81%) Frame = +2 Query: 374 HYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLXLRHRVRYGQLLISKIREEXPDRIM 553 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSL G LLISKIREE PDRIM Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 95.5 bits (227), Expect = 1e-21 Identities = 47/60 (78%), Positives = 49/60 (81%) Frame = +2 Query: 374 HYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLXLRHRVRYGQLLISKIREEXPDRIM 553 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSL G LLISKIREE PDRIM Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 95.5 bits (227), Expect = 1e-21 Identities = 47/60 (78%), Positives = 49/60 (81%) Frame = +2 Query: 374 HYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLXLRHRVRYGQLLISKIREEXPDRIM 553 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSL G LLISKIREE PDRIM Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 95.5 bits (227), Expect = 1e-21 Identities = 47/60 (78%), Positives = 49/60 (81%) Frame = +2 Query: 374 HYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLXLRHRVRYGQLLISKIREEXPDRIM 553 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSL G LLISKIREE PDRIM Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 25.8 bits (54), Expect = 1.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 62 MREIVHLQAGQCGNQIGAKFWE 127 MRE + + GQ G QIG W+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 5.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 335 FGQSGAGNNWAKGHYTEGAELVDSVLDVV 421 FG G + G YT +E +D VLD + Sbjct: 343 FGLEQCGTDGVPGVYTRMSEYMDWVLDTM 371 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 23.0 bits (47), Expect = 7.3 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 Query: 153 SMPCSSEMISQNLAPIWLPHWPACR*TIS 67 SM C + ++ I L W CR TIS Sbjct: 335 SMECFDALRKADIYAIGLIFWEVCRRTIS 363 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 116 KFWEIISDEHGIDPTG 163 KFW + D GI+ TG Sbjct: 225 KFWPTVCDYFGIESTG 240 >EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 >EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.6 bits (46), Expect = 9.7 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = -1 Query: 380 CSVPWPSCCQ 351 C+ PW CC+ Sbjct: 66 CNTPWADCCK 75 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,482 Number of Sequences: 2352 Number of extensions: 15012 Number of successful extensions: 118 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -