BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0814 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related prot... 24 3.7 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 6.4 >Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related protease protein. Length = 273 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 453 TQMEDESEEAYDNYGNNNDMVFKRNLKRATTG 548 T + E +AY +YG + +F K+ TG Sbjct: 191 TVNQQECNQAYQSYGGITEQMFCAGYKQGGTG 222 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 23.4 bits (48), Expect = 6.4 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 412 VTVSTSRLLSVAALTGIFFPLNTLPLAFFIASCAL 308 VTV+T+ S AA+ + LPLA I AL Sbjct: 15 VTVATATSTSPAAMASLVLDHTELPLAGTIPPAAL 49 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,390 Number of Sequences: 2352 Number of extensions: 13301 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -