BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0813 (706 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosa... 27 3.5 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 27 3.5 SPBC18H10.11c |||conserved fungal protein|Schizosaccharomyces po... 26 4.6 >SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosaccharomyces pombe|chr 1|||Manual Length = 1162 Score = 26.6 bits (56), Expect = 3.5 Identities = 12/45 (26%), Positives = 26/45 (57%) Frame = +1 Query: 73 PPIKLEEYSETMESDILNWGNKEVEELLHKENISSCLIXICKTHD 207 PP + + +E + +LN + +++ L K N+++C I +C + D Sbjct: 1118 PPARFGDVTEVTK--VLNRESVKLDHYLTKTNLNTCYISMCLSCD 1160 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 26.6 bits (56), Expect = 3.5 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +3 Query: 330 RSAMMELGLCDDLINPATNINFLGT--NLSHLS 422 ++ + E +C D INP+T+I GT ++ HLS Sbjct: 191 KNRLYECSVCTDTINPSTSIWSCGTCYHVFHLS 223 >SPBC18H10.11c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 26.2 bits (55), Expect = 4.6 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +1 Query: 82 KLEEYSETMESDILNWGNKEVEELLHKENISSCLIXI 192 KL EYSE + + L N L H IS C + + Sbjct: 168 KLREYSEKVTASALKESNNVTSNLHHIRIISKCSLKL 204 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,811,183 Number of Sequences: 5004 Number of extensions: 53049 Number of successful extensions: 121 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -