BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0810 (883 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z66519-5|CAA91382.2| 500|Caenorhabditis elegans Hypothetical pr... 28 7.7 >Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical protein F08H9.1 protein. Length = 607 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -2 Query: 405 RSPHENIEVLSVVEDSEDFD 346 R+P+ENI++L +DSED D Sbjct: 581 RAPYENIDLLLSTDDSEDID 600 >Z66519-5|CAA91382.2| 500|Caenorhabditis elegans Hypothetical protein B0334.5 protein. Length = 500 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/65 (23%), Positives = 29/65 (44%) Frame = +2 Query: 89 VFTKEPMVNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYNIEKSCDKYMNVDALSSS 268 +F K+ V M+ + ++ HI QP ++ I N+E + + + +S Sbjct: 68 LFIKKDQVTPRPIMRRSTQLSIIHHIRQPCQ-SNVPRICDAPNLETTATSTTKLFSWNSQ 126 Query: 269 WRCIR 283 W C+R Sbjct: 127 WTCLR 131 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,144,268 Number of Sequences: 27780 Number of extensions: 395468 Number of successful extensions: 938 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2223883816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -