BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0808 (803 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02980.1 68414.m00268 cullin family protein similar to cullin... 31 1.2 At4g02570.1 68417.m00351 cullin family protein similar to cullin... 28 8.3 >At1g02980.1 68414.m00268 cullin family protein similar to cullin 1 [Homo sapiens] GI:3139077; contains Pfam profile PF00888: Cullin family Length = 742 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +3 Query: 426 YISNDVVGVMSDRHAGHRWRRHIPRWRQAGSI*RLVDHRMWYIDRFFDMHG 578 Y V+ + ++H + R + RW + R + H Y+DRF+ G Sbjct: 74 YNKQTVLPAIREKHGEYMLRELVKRWANQKILVRWLSHFFEYLDRFYTRRG 124 >At4g02570.1 68417.m00351 cullin family protein similar to cullin 3 [Homo sapiens] GI:3639052; contains Pfam profile PF00888: Cullin family Length = 738 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +3 Query: 426 YISNDVVGVMSDRHAGHRWRRHIPRWRQAGSI*RLVDHRMWYIDRFF 566 YI++ V+ + ++H R RW + R + +Y+DR+F Sbjct: 73 YINSTVLPALREKHDEFMLRELFKRWSNHKVMVRWLSRFFYYLDRYF 119 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,406,599 Number of Sequences: 28952 Number of extensions: 300278 Number of successful extensions: 630 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1824072800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -