BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0807 (736 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 23 2.6 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 22 5.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 7.8 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/55 (21%), Positives = 24/55 (43%) Frame = +2 Query: 350 GLAFTLSDNGGVAYGDSKDRTSSRVSWKFIPLWENNKVYFKIENTERKQNLALKS 514 G+ SDN Y + + ++++ W +N+ + + RK+ LKS Sbjct: 186 GIKLNASDNDKDGYKRAVYKIGQLLTYRAPRPWIHNETIYSLTPQGRKEQKVLKS 240 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/55 (21%), Positives = 23/55 (41%) Frame = +2 Query: 350 GLAFTLSDNGGVAYGDSKDRTSSRVSWKFIPLWENNKVYFKIENTERKQNLALKS 514 G+ SDN Y + + ++++ W N+ + + RK+ LKS Sbjct: 186 GIKLNASDNDKDGYKRAVYKIGQLLTYRAPRPWIYNETIYSLTPQGRKEQKVLKS 240 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 563 MVLGPSGTWFPLN 601 ++ GPS TWF N Sbjct: 1138 VIYGPSDTWFDEN 1150 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,632 Number of Sequences: 336 Number of extensions: 3095 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -