BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0807 (736 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schi... 28 1.2 SPAC110.02 |pds5||cohesin-associated protein Pds5|Schizosaccharo... 26 4.8 >SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schizosaccharomyces pombe|chr 3|||Manual Length = 215 Score = 28.3 bits (60), Expect = 1.2 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = +3 Query: 87 LAEHLYNDVIIADYDSAVERSK----LIYTDNKGXLITNVVNNLIRNNKMNCMEYAYQLW 254 LAE + + D +S E K LI K L ++ +++ NK+N +E A Q W Sbjct: 110 LAESNSSVAVEGDENSYAETPKKKHSLIRKRRKSPLDSSSAQKVLKKNKLNTLEQAQQNW 169 Query: 255 CK 260 K Sbjct: 170 SK 171 >SPAC110.02 |pds5||cohesin-associated protein Pds5|Schizosaccharomyces pombe|chr 1|||Manual Length = 1205 Score = 26.2 bits (55), Expect = 4.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 246 QLWCKAPRTSSGIVSRLSSHLS*LKTMLSLCTGETVSLL 362 QLW AP T I+ + + L +T + L ETV L+ Sbjct: 266 QLWKYAPTTLLNIIPQFENELQAEQTSVRLVAIETVGLM 304 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,721,428 Number of Sequences: 5004 Number of extensions: 51479 Number of successful extensions: 119 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -