BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0807 (736 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7282| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_51126| Best HMM Match : MSG (HMM E-Value=6.4) 28 9.0 SB_34186| Best HMM Match : Cyt-b5 (HMM E-Value=2.6e-13) 28 9.0 >SB_7282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 682 PKLSIVLDSVKAML*SRLKMKNKLRYLIQRE 590 P++ ++ S KA RLK K KLR L+ RE Sbjct: 1525 PRILVLAQSFKAGSHERLKRKQKLRSLMSRE 1555 >SB_51126| Best HMM Match : MSG (HMM E-Value=6.4) Length = 194 Score = 27.9 bits (59), Expect = 9.0 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 359 FTLSDNGGVAYGDSKDRTSSRV-SWKFIPLWENNKVYFKIENTERKQNL 502 FTL D+ YG+ K+ S+V S + L +NKVY T ++ L Sbjct: 101 FTLRDDRNKFYGNRKEIAGSKVSSISSLALESDNKVYISESLTPSRKKL 149 >SB_34186| Best HMM Match : Cyt-b5 (HMM E-Value=2.6e-13) Length = 310 Score = 27.9 bits (59), Expect = 9.0 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -3 Query: 602 NSAGTRYHWALKPSKLATP*AMWSPFLLVRTSMPSS 495 NSAG + WA P L P A + VRT+ PSS Sbjct: 242 NSAGIQREWAGVPRMLFKPGAKQPRCVCVRTTGPSS 277 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,229,201 Number of Sequences: 59808 Number of extensions: 420870 Number of successful extensions: 1022 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1012 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -