BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0807 (736 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 3.2 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 5.6 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 5.6 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 9.8 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.6 bits (51), Expect = 3.2 Identities = 19/70 (27%), Positives = 31/70 (44%) Frame = +2 Query: 200 QSDTKQQDELHGVRLPALVQGSEDIVRDCFPVEFTLILAENYVKLMYRRDGLAFTLSDNG 379 Q K QD L + AL +D+V + +LA + +L+ + L T+SD Sbjct: 258 QEIQKAQDRLKNAQ-KALKDAKKDVVT---AKDEKSVLATEHQQLLREKTKLDLTISDLS 313 Query: 380 GVAYGDSKDR 409 GD+K + Sbjct: 314 DEVQGDNKSK 323 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 5.6 Identities = 11/47 (23%), Positives = 24/47 (51%) Frame = +3 Query: 45 ASLYADEGTAFNEILAEHLYNDVIIADYDSAVERSKLIYTDNKGXLI 185 A L+ +I +H+ +DV+++++ S + S L + N+ I Sbjct: 1974 APLHRHRVENIQKISGDHILSDVLLSNHQSQIITSALYSSGNESLAI 2020 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 5.6 Identities = 11/47 (23%), Positives = 24/47 (51%) Frame = +3 Query: 45 ASLYADEGTAFNEILAEHLYNDVIIADYDSAVERSKLIYTDNKGXLI 185 A L+ +I +H+ +DV+++++ S + S L + N+ I Sbjct: 1975 APLHRHRVENIQKISGDHILSDVLLSNHQSQIITSALYSSGNESLAI 2021 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +2 Query: 434 FIPLWENNKVYFKIEN-TERKQN-LALKSEL 520 F+P+W YF + N TE ++ L L+ EL Sbjct: 161 FMPVWTTYSAYFAVRNSTEPVEHVLHLEEEL 191 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 704,138 Number of Sequences: 2352 Number of extensions: 13716 Number of successful extensions: 24 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -