BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0799 (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 24 1.4 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 3.3 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 3.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 3.3 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 24.2 bits (50), Expect = 1.4 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 376 HTWWPRRALGC 408 HTWWP L C Sbjct: 163 HTWWPYDILNC 173 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 361 PSAQPPTATMNLTSGCLERRDVKL 290 P QPP+A NLT +++ V L Sbjct: 313 PCTQPPSAPQNLTVNFVDQSTVFL 336 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +1 Query: 247 LIMILSWTWIRVVSVTSHPSAPNTPMSSSWSR 342 +I++ WI V + H +P+T S W R Sbjct: 320 MILVTLSIWITVCVLNVHFRSPSTHNMSPWVR 351 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 3.3 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 596 RQQSAPILYRL**TPSLTLGRNTRTCLYRKGATPVSG 486 R + APIL R TP+ T T C P++G Sbjct: 194 RDKVAPILVRARETPNYTACPPTLACPLNPNPQPLTG 230 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 231,431 Number of Sequences: 438 Number of extensions: 5475 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -