BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0797 (775 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 45 8e-07 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 37 2e-04 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 2.7 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.7 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 8.3 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 44.8 bits (101), Expect = 8e-07 Identities = 25/77 (32%), Positives = 36/77 (46%) Frame = +2 Query: 299 LPRGETFVHTNELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERINGGMFVYAFTAACFH 478 L R E F + A K+ R+ A+ D + A + R+R+N +F YAF+ A H Sbjct: 74 LGRHENFSLFIPKHRKVAGKLIRIFLAAESIDDLLSNAVFCRDRVNPYLFYYAFSVALLH 133 Query: 479 RTDCKGLYLPLLTRSIP 529 R D + L LP P Sbjct: 134 RPDTQNLDLPSFIHVFP 150 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 37.1 bits (82), Expect = 2e-04 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +2 Query: 383 KDFDVFMRTACWMRERINGGMFVYAFTAACFHRTDCKGLYLPLLTRSIP 529 ++ D + A + R+R+N +F YA + A HR D + + LP S P Sbjct: 102 RNVDDLLSVAVYARDRVNPYLFSYALSVAILHRQDTQDIDLPSFIESFP 150 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 609 PEDRVLGGFSHLHHKGFTDDMAVNEE 532 P V F+HL H+ FT + VN + Sbjct: 466 PRGSVFVRFTHLQHQPFTYKITVNNQ 491 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 723 DVXHEIDITSFWDKERRTP 667 D HE + T WD E++ P Sbjct: 804 DFLHEDNTTLVWDNEQQVP 822 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 451 DEHASVDPFSHPARSPHENIEVLSVVEDSEDFDGFF 344 D ++ P + P R P +N + L +E S + G F Sbjct: 125 DMETTLTPCASPNRKPDDNQDHLRRLEMSLEKSGLF 160 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 126 DMKMKELCIMKLLDHI 173 D K+ LC+ L+DH+ Sbjct: 442 DEKLNALCMTWLMDHV 457 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,168 Number of Sequences: 336 Number of extensions: 3543 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -