BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0796 (780 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 25 2.6 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 24 6.1 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 24 6.1 AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 24 6.1 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 8.0 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 25.0 bits (52), Expect = 2.6 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 8 VDEIKEKLIEHVIDKRDRNGQFMFPRLRHLLVSCWGNYAWD 130 +D+ K+ E V D N + P +R +L SC G +A+D Sbjct: 219 MDDSGLKVDEVVRDFNLINKSDLEPEVRSVLASCTGTHAYD 259 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 434 KAL*RNYFQRLLLYLNYGKNF 496 K+L R Y R +YLN G NF Sbjct: 90 KSLQREYADRNPIYLNAGDNF 110 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 434 KAL*RNYFQRLLLYLNYGKNF 496 K+L R Y R +YLN G NF Sbjct: 90 KSLQREYADRNPIYLNAGDNF 110 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 23.8 bits (49), Expect = 6.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 413 WLKNIHNKAL*RNYFQRLLLYLN 481 WL + ++A + F+RLLLY N Sbjct: 292 WLSTLESEAWNQANFERLLLYPN 314 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 8.0 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 152 ENHFIVANAVYRGRPVTESNIQEYISDIVSKYF 250 +N F A+ R + NI +Y+ DI+ YF Sbjct: 556 KNAFNSASWTAIARSLQRINIPKYLYDIIGNYF 588 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 810,252 Number of Sequences: 2352 Number of extensions: 16956 Number of successful extensions: 29 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -