BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0795 (732 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces ... 26 4.8 SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces po... 26 4.8 >SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1502 Score = 26.2 bits (55), Expect = 4.8 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 253 FQAYSSRSQASADAGAQILRLNNEVTAEGFSYDF 354 +Q +SSR +A+ D+ N E TAE FS++F Sbjct: 1283 YQPFSSR-KAALDSIIHFDLFNAESTAEAFSFEF 1315 >SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 658 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 404 VSSPKAASPTRVMMVRTIVSLTLPTRTDTSP 496 VS+ + +P M+ T+ + TLPT T+P Sbjct: 242 VSTIRTTTPMEAMITPTVETTTLPTAAMTTP 272 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,997,536 Number of Sequences: 5004 Number of extensions: 29995 Number of successful extensions: 68 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -