BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0795 (732 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17447| Best HMM Match : zf-B_box (HMM E-Value=0.04) 31 1.3 SB_26157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_16648| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 >SB_17447| Best HMM Match : zf-B_box (HMM E-Value=0.04) Length = 1223 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = +2 Query: 395 PLTVSSPKAASPTRVMMVRTIVSLTLPTRTDTSPRARISXLLPRSPR 535 P+TVSS A + T + RT+ SLT P T A+ + P SPR Sbjct: 978 PVTVSSKPAIALTTLAPQRTLSSLTGPLIKTTVSPAKTTLSNPSSPR 1024 >SB_26157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1097 Score = 29.1 bits (62), Expect = 3.9 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +2 Query: 395 PLTVSSPKAASPTRVMMVRTIVSLTLPTRTDTSPRARIS--XLLPRSPRKS*NLWSXTPV 568 P T +S A SPT + + + L + TD++ R++ S +LP+ W + Sbjct: 912 PTTPTSSGAGSPTEIALPTALPMPALDSPTDSNDRSKKSKRGVLPKQATSIMKTWLFQHI 971 Query: 569 MRP 577 M P Sbjct: 972 MHP 974 >SB_16648| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 6.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 388 GVATNGVQSQGSFAYKGDDGQDYSITYTADENG 486 G+ NG + GS++Y DD D+ + D NG Sbjct: 15 GIVDNGNNNGGSYSYNNDD-DDFIVGGIGDNNG 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,850,186 Number of Sequences: 59808 Number of extensions: 272752 Number of successful extensions: 666 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -