BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0793 (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 22 5.5 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 5.5 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 148 DKKKQGHKTSVRYL 189 DK+KQG KT +++L Sbjct: 79 DKQKQGAKTVIQHL 92 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/49 (20%), Positives = 22/49 (44%) Frame = +3 Query: 462 DVQSKAKTQQAKLRFNFWRARRSASRLWQKTSSISSSQQVILKRQTASF 608 ++ +AK + L++ FW + Q + ++ S + + ASF Sbjct: 1264 NLSHQAKNLDSNLKYEFWVTAATTIGEGQPSKKVTVSPSASVPAKIASF 1312 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,236 Number of Sequences: 336 Number of extensions: 3323 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -