BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0792 (614 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125442-2|AAD12792.1| 360|Caenorhabditis elegans Serpentine re... 30 1.1 Z81489-10|CAB04004.2| 337|Caenorhabditis elegans Hypothetical p... 30 1.5 AF016678-3|AAB66150.2| 297|Caenorhabditis elegans Hypothetical ... 28 4.6 AF016433-2|AAB65389.1| 336|Caenorhabditis elegans Seven tm rece... 27 8.1 >AF125442-2|AAD12792.1| 360|Caenorhabditis elegans Serpentine receptor, class v protein19 protein. Length = 360 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = -2 Query: 361 NVNIIN*SSLKSF*CVIVELICFLTILFVNWKIVWLNKPELLIELKPRTNLLMKVC 194 N NII S+ +F VI+ + L + WK + +LI L+ L +VC Sbjct: 225 NPNIIKKSTKTAFVFVIISCLICLIFYSLIWKFIKTRSQTVLISLQREIRLAFQVC 280 >Z81489-10|CAB04004.2| 337|Caenorhabditis elegans Hypothetical protein C55A1.8 protein. Length = 337 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/32 (37%), Positives = 23/32 (71%) Frame = +1 Query: 454 ITIKTLFGLALSLGNITFFLKVSFYSIKKEKK 549 ++I ++F L+ ++ + FLK+SF+SIK +K Sbjct: 28 VSIFSIFVLSYTISSFYIFLKLSFFSIKDREK 59 >AF016678-3|AAB66150.2| 297|Caenorhabditis elegans Hypothetical protein K07E8.5 protein. Length = 297 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -2 Query: 304 LICFLTILFVNWKIVWLNKPELLIELKPRTNLLMKV---C*LNCYLV 173 + C T L VN+ + LN P +L+ +NLL+ V CYL+ Sbjct: 211 IFCNFTALMVNFMEIILNDPSMLVYFVDLSNLLVVVNGTANFFCYLI 257 >AF016433-2|AAB65389.1| 336|Caenorhabditis elegans Seven tm receptor protein 143 protein. Length = 336 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -2 Query: 319 CVIVELICFLTILFVNWKI-VWLNKPELLIELKPR 218 C++V + CF TIL+ +KI + L + L+ K R Sbjct: 208 CILVMVACFSTILYCAFKIYIRLKSAQALMSTKTR 242 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,628,044 Number of Sequences: 27780 Number of extensions: 180531 Number of successful extensions: 328 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -