BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0788 (726 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 25 8.3 SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|ch... 25 8.3 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 25.4 bits (53), Expect = 8.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 115 DVIHSYYPFLYSNSIPNFL 171 D++H Y P Y +S+P L Sbjct: 38 DIVHGYTPATYLSSVPTLL 56 >SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|chr 3|||Manual Length = 862 Score = 25.4 bits (53), Expect = 8.3 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 9/44 (20%) Frame = +2 Query: 263 FDRALWVVEKCAR--WAVPPPLDQDE-------RPQPELIRPLP 367 F RA +V+ A+ W PP + ++ RP+P L +PLP Sbjct: 786 FQRAWQIVQSTAKSIWHSDPPKESEKGFVVLRSRPRPNLQKPLP 829 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,703,024 Number of Sequences: 5004 Number of extensions: 51781 Number of successful extensions: 132 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -