BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0788 (726 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0883 + 21279913-21280235,21281066-21281327,21281998-212821... 32 0.53 09_04_0568 + 18591757-18592251 30 2.2 12_01_1111 + 11842837-11843094,11843142-11843255,11843267-118442... 29 3.8 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 29 3.8 06_02_0341 + 14778915-14778961,14778982-14779860,14780101-14782804 29 3.8 04_04_1296 + 32437089-32437386,32437422-32437429 29 5.0 11_06_0016 - 19284810-19284926,19285527-19286879 28 6.6 08_01_1066 - 10887509-10888171,10888782-10888964,10889234-10889497 28 6.6 11_06_0011 + 19245742-19246440,19248361-19249170 28 8.7 06_01_0739 + 5468642-5468857,5468978-5469051,5469651-5470083 28 8.7 02_05_0910 - 32684836-32685259,32685911-32685987,32686179-32686421 28 8.7 >10_08_0883 + 21279913-21280235,21281066-21281327,21281998-21282199, 21282289-21282436,21282541-21283084 Length = 492 Score = 31.9 bits (69), Expect = 0.53 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 605 SNIDLIPLYQVSRGWLAVLVRARXMRFPWY 516 SN L+PL V WLA++ M FPWY Sbjct: 405 SNAFLLPLLAVLTPWLAIIGMFFVMAFPWY 434 >09_04_0568 + 18591757-18592251 Length = 164 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Frame = -3 Query: 604 QTSI*SRCTRCRG----AGWRCWCGLAXCG 527 +TS +RC+RCR G+RC CG CG Sbjct: 98 KTSAVNRCSRCRKRVGLTGFRCRCGHLFCG 127 >12_01_1111 + 11842837-11843094,11843142-11843255,11843267-11844247, 11861747-11862025,11862998-11863098,11863723-11863792, 11863947-11863974,11864057-11864114,11864440-11864536 Length = 661 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 191 DKGNASDFGRARGQLPRWPDYVRYFDRALW 280 D G R L RWP+Y R D+ LW Sbjct: 412 DNGMGGAIMRRAEALARWPEYQRLVDQELW 441 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 278 WVVEKCARWAVPPPLDQDERPQPELIRPLP 367 W + KC R+A PPP P P + P P Sbjct: 37 WRLAKCPRFAPPPPQPTLPPPPPRTLPPPP 66 >06_02_0341 + 14778915-14778961,14778982-14779860,14780101-14782804 Length = 1209 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 191 DKGNASDFGRARGQLPRWPDYVRYFDRALW 280 D G R L RWP+Y R D+ LW Sbjct: 347 DNGMGGAIMRRAEALARWPEYQRLVDQELW 376 >04_04_1296 + 32437089-32437386,32437422-32437429 Length = 101 Score = 28.7 bits (61), Expect = 5.0 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -2 Query: 347 LVAGARLDPKVEARPISHISRPPTMLYRNTVRSLASAVA 231 +VA RL P+ +P S + PP +L R + R L +AVA Sbjct: 27 VVASVRLGPE-SMQPASAMQAPPQLLLRYSNRHLRNAVA 64 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 311 PPPLDQDERPQPELIRPLPWVFFLMMLIAL 400 PPP RP P L LP+ F+L ++L Sbjct: 90 PPPPPPPPRPAPSLASALPFWFYLTAAVSL 119 >08_01_1066 - 10887509-10888171,10888782-10888964,10889234-10889497 Length = 369 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 477 CTYKANV-DIYGPQVPGEPHXASPHQHRQPAPRHLVQ 584 C Y N+ + + G P A H Q AP HLV+ Sbjct: 169 CVYSDNMPEFFAADATGNPREAPEEGHGQRAPPHLVR 205 >11_06_0011 + 19245742-19246440,19248361-19249170 Length = 502 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 483 YKANVDIYGPQVPGEPHXASPHQHRQPAPRHLVQR 587 Y+ V GP G+P A +H++ A RHL++R Sbjct: 59 YQPQVVSLGPFHHGDPGLAPMEEHKRRALRHLLRR 93 >06_01_0739 + 5468642-5468857,5468978-5469051,5469651-5470083 Length = 240 Score = 27.9 bits (59), Expect = 8.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 Query: 589 SRCTRCRGAGWRC 551 SRC+R G GWRC Sbjct: 157 SRCSRVNGRGWRC 169 >02_05_0910 - 32684836-32685259,32685911-32685987,32686179-32686421 Length = 247 Score = 27.9 bits (59), Expect = 8.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 Query: 589 SRCTRCRGAGWRC 551 SRC+R G GWRC Sbjct: 169 SRCSRVNGRGWRC 181 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,191,540 Number of Sequences: 37544 Number of extensions: 372709 Number of successful extensions: 1167 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1166 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -