BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0786 (662 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 25 2.1 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 25 2.8 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 25.0 bits (52), Expect = 2.1 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 314 RTGLFNKPELTTFEGFYTLKDQAIEATDRLIEXATNSPTRPM 439 RT K E +YT + R++E PT+P+ Sbjct: 5 RTKTIKKASKVIIEKYYTRLTMDFDTNKRIVEEVAIIPTKPL 46 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 24.6 bits (51), Expect = 2.8 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +1 Query: 508 THPQPHFARAAEEACISISGVVEKLNTHKG 597 TH +PH + A + +S + + TH G Sbjct: 207 THERPHKCTECDYASVELSKLKRHIRTHTG 236 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,836 Number of Sequences: 2352 Number of extensions: 13100 Number of successful extensions: 68 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -