BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0785 (454 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15810| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 2e-15 SB_28668| Best HMM Match : UCH (HMM E-Value=8e-12) 37 0.009 SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) 36 0.021 SB_43026| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.027 SB_16638| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.027 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.027 SB_6591| Best HMM Match : UCH (HMM E-Value=0.00022) 35 0.027 SB_16315| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.036 SB_41240| Best HMM Match : UCH (HMM E-Value=9.2e-25) 33 0.15 SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.19 SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.19 SB_8927| Best HMM Match : UCH (HMM E-Value=0) 31 0.34 SB_18912| Best HMM Match : UCH (HMM E-Value=5.3e-06) 31 0.59 SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) 30 0.78 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_997| Best HMM Match : Hexapep (HMM E-Value=6.8e-15) 27 5.5 SB_21866| Best HMM Match : UCH (HMM E-Value=0) 27 5.5 SB_20219| Best HMM Match : UCH (HMM E-Value=2.7e-06) 27 7.3 SB_24189| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) 27 9.6 SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_15810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 78.6 bits (185), Expect = 2e-15 Identities = 36/56 (64%), Positives = 46/56 (82%) Frame = +1 Query: 286 VLVMGSKEEDVPAAPVEQTRFVEDMNEAELATAMDMPEGLINLGNTCYMNATVQCL 453 +++MGS D+P APV +T F+EDM+EA+LA+A +P GL NLGNTCYMNATVQCL Sbjct: 61 LMMMGSVG-DIPTAPVRKTVFMEDMSEAQLASAFKLPAGLNNLGNTCYMNATVQCL 115 Score = 68.1 bits (159), Expect = 3e-12 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = +2 Query: 95 SVKVKWGKEMYPDVEVNTDDEPVLFKAQIFALTGVQPEXQKVVCKGVTLRDDT 253 SV VKWGKE + VE+NTD+ P +FKAQ+FAL+ V PE QKV+ KG L+ T Sbjct: 8 SVNVKWGKEKFGGVELNTDEPPQVFKAQLFALSSVPPERQKVMLKGAVLQGVT 60 >SB_28668| Best HMM Match : UCH (HMM E-Value=8e-12) Length = 893 Score = 36.7 bits (81), Expect = 0.009 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL NLGNTCYMN+ +QCL Sbjct: 697 GLRNLGNTCYMNSVLQCL 714 >SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) Length = 1712 Score = 35.5 bits (78), Expect = 0.021 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL NLGNTC+MNA +QCL Sbjct: 465 GLENLGNTCFMNAGLQCL 482 >SB_43026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 35.1 bits (77), Expect = 0.027 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +1 Query: 385 MDMPEGLINLGNTCYMNATVQCL 453 + + GL NLGNTCY+NAT+Q L Sbjct: 52 LGLVRGLKNLGNTCYLNATLQML 74 >SB_16638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 35.1 bits (77), Expect = 0.027 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL NLGNTC+MN+ +QCL Sbjct: 223 GLANLGNTCFMNSGLQCL 240 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 35.1 bits (77), Expect = 0.027 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL+NLGNTCYMN+ +Q L Sbjct: 404 GLVNLGNTCYMNSVLQSL 421 >SB_6591| Best HMM Match : UCH (HMM E-Value=0.00022) Length = 340 Score = 35.1 bits (77), Expect = 0.027 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL+N+GNTCYMNA +Q L Sbjct: 124 GLMNIGNTCYMNAALQAL 141 >SB_16315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 34.7 bits (76), Expect = 0.036 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GLINLGNTC+MN VQ L Sbjct: 40 GLINLGNTCFMNCIVQAL 57 >SB_41240| Best HMM Match : UCH (HMM E-Value=9.2e-25) Length = 1088 Score = 32.7 bits (71), Expect = 0.15 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL NLGNTCYMN+ +Q L Sbjct: 216 GLRNLGNTCYMNSVLQVL 233 >SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2578 Score = 32.3 bits (70), Expect = 0.19 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL N GNTC++NA +QCL Sbjct: 1950 GLKNHGNTCFINAIIQCL 1967 >SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 32.3 bits (70), Expect = 0.19 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +1 Query: 391 MPEGLINLGNTCYMNATVQCL 453 M GL NLGNTC++N+ VQ L Sbjct: 114 MGPGLSNLGNTCFLNSVVQVL 134 >SB_8927| Best HMM Match : UCH (HMM E-Value=0) Length = 316 Score = 31.5 bits (68), Expect = 0.34 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL+N GNTCY N+ +Q L Sbjct: 24 GLVNFGNTCYCNSVLQAL 41 >SB_18912| Best HMM Match : UCH (HMM E-Value=5.3e-06) Length = 781 Score = 30.7 bits (66), Expect = 0.59 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +1 Query: 409 NLGNTCYMNATVQCL 453 NLGNTCYMNA +Q L Sbjct: 608 NLGNTCYMNAILQSL 622 >SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) Length = 362 Score = 30.3 bits (65), Expect = 0.78 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 346 FVEDMNEAELATAMDMPEGLINLGNTCYMNATVQ 447 FV+ +N + P G N+GNTC+ +A +Q Sbjct: 219 FVDPVNPYDRKRVEGTPVGFKNVGNTCWFSAVIQ 252 >SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2708 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 G+INLG TCYM + +Q L Sbjct: 1123 GIINLGATCYMASCIQQL 1140 >SB_997| Best HMM Match : Hexapep (HMM E-Value=6.8e-15) Length = 916 Score = 27.5 bits (58), Expect = 5.5 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = +2 Query: 98 VKVKWGKEMYPDVEVNTDDEPVLFKAQIFALTGVQPEXQKVVCKGVTLRDD 250 V V G E+ DV+V D +P+L + G+ + V GVTL DD Sbjct: 481 VDVVDGVELLDDVDVVDDGDPLLDNVDVVEDVGLLEDVD--VVDGVTLLDD 529 >SB_21866| Best HMM Match : UCH (HMM E-Value=0) Length = 2165 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL N G TCYMN+ +Q L Sbjct: 1257 GLKNAGATCYMNSVIQQL 1274 >SB_20219| Best HMM Match : UCH (HMM E-Value=2.7e-06) Length = 543 Score = 27.1 bits (57), Expect = 7.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL N G TCY+N+ +Q L Sbjct: 43 GLQNQGGTCYLNSLIQTL 60 >SB_24189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL N G TCYMN+ +Q L Sbjct: 282 GLKNQGATCYMNSLLQTL 299 >SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) Length = 711 Score = 26.6 bits (56), Expect = 9.6 Identities = 20/72 (27%), Positives = 30/72 (41%) Frame = +1 Query: 226 QRSHITG*HMGNFKLTNNALVLVMGSKEEDVPAAPVEQTRFVEDMNEAELATAMDMPEGL 405 QR+ G M NF L L +++ P + VEQ VE M + + + G Sbjct: 366 QRNQKEGERMDNFVSELKRLSLTW---KKETPVSTVEQENQVESMGQGDRGGDPHLYFGS 422 Query: 406 INLGNTCYMNAT 441 + LG N+T Sbjct: 423 VELGTVSSPNST 434 >SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL N G TCYMN+ +Q L Sbjct: 6 GLKNAGATCYMNSVLQQL 23 >SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 400 GLINLGNTCYMNATVQCL 453 GL N G TCYMN+ +Q L Sbjct: 6 GLKNAGATCYMNSVLQQL 23 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,766,616 Number of Sequences: 59808 Number of extensions: 306746 Number of successful extensions: 711 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 908427626 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -