BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0782 (744 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC191.11 |inv1||beta-fructofuranosidase|Schizosaccharomyces po... 26 6.5 SPCC548.07c |ght1||hexose transporter Ght1 |Schizosaccharomyces ... 25 8.6 >SPCC191.11 |inv1||beta-fructofuranosidase|Schizosaccharomyces pombe|chr 3|||Manual Length = 581 Score = 25.8 bits (54), Expect = 6.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 318 SGVNHVDDDSGFRQINLGLDLIAAHCFFSS 229 +G N V DD R ++LG D A+ + SS Sbjct: 322 NGTNFVPDDGQTRFVDLGKDFYASALYHSS 351 >SPCC548.07c |ght1||hexose transporter Ght1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 624 SVRYLINISNNRNQGSYCCRNRILPPET*LXEVVIK 731 S RYL++I + C+N LPP++ + + K Sbjct: 202 SPRYLVSIGKDDEAIQVMCKNAELPPDSDIIQTEYK 237 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,981,651 Number of Sequences: 5004 Number of extensions: 62165 Number of successful extensions: 185 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -