BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0781 (715 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0205 - 41978437-41980599,41980805-41981215 29 3.7 07_03_0335 - 16903775-16904118,16904203-16904325,16904424-16905993 28 6.4 >01_07_0205 - 41978437-41980599,41980805-41981215 Length = 857 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -3 Query: 182 LSQKLFCELKHRIV-FALGCDERLIWTIE 99 L +L+CEL +V +A C+ER +W IE Sbjct: 311 LRSRLYCELDDWLVSWADACEERSVWRIE 339 >07_03_0335 - 16903775-16904118,16904203-16904325,16904424-16905993 Length = 678 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +3 Query: 171 FLTEDYANNGIELNNRFGDDASEKIPLKTSANSQNLKLQLNYPRTL 308 F+TE AN GI + N G +ASEK ++ S ++ ++ Q N+ L Sbjct: 354 FVTEKMANEGISVPNLEG-EASEKSSVEDSDSTSSVTDQENHKLVL 398 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,193,407 Number of Sequences: 37544 Number of extensions: 362768 Number of successful extensions: 854 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -