BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0774 (668 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Pa... 27 3.2 SPBC1711.09c |||SNARE associated Golgi protein |Schizosaccharomy... 26 5.6 >SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Par2|Schizosaccharomyces pombe|chr 1|||Manual Length = 627 Score = 26.6 bits (56), Expect = 3.2 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +1 Query: 508 RSKSNVAMNAWLPQASYPCGNFSGTLLKTLYTKGSIGRAFAVPMRTEH 651 RS +MN Q Y F G + + L GSI FAVP++ EH Sbjct: 377 RSYIRKSMNNVFLQFIYEREKFHG-IAELLEILGSIINGFAVPLKEEH 423 >SPBC1711.09c |||SNARE associated Golgi protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 270 Score = 25.8 bits (54), Expect = 5.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 4 IRHETIPSPDIELSYIRTFGAVMHVLRKKTDSIDLR 111 +R++ I + +E S T + H+ + TDSIDLR Sbjct: 211 VRYKAIKNSTLEDSTNSTSDVLNHLESQPTDSIDLR 246 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,746,750 Number of Sequences: 5004 Number of extensions: 53901 Number of successful extensions: 122 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 305854096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -