BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0774 (668 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0486 - 3495792-3496034,3496862-3496934,3497128-3497422,349... 33 0.16 06_03_1055 - 27234824-27234838,27236087-27236125,27236322-272373... 31 1.1 07_03_0846 - 21983581-21986055 29 2.5 01_06_1280 - 35959452-35960105 29 2.5 08_01_0370 + 3275771-3275789,3275972-3276976,3277062-3277624 29 3.3 08_02_1344 - 26280554-26280785,26281558-26282182,26282718-26284224 29 4.4 09_04_0407 + 17345382-17345579,17345711-17346235 28 5.9 >02_01_0486 - 3495792-3496034,3496862-3496934,3497128-3497422, 3497585-3497759,3498349-3498795,3499994-3500053 Length = 430 Score = 33.5 bits (73), Expect = 0.16 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = -1 Query: 353 VREEPQFRTFGSCTRPSGRWCEATIRGIMPER-LKAEASLAESGKDMLTVEPRESGGSKQ 177 + P G RP+ +++IRGI+P+R KA++SL + + +L + S +Q Sbjct: 60 ISPSPNSARSGLPPRPNSTRTKSSIRGIIPQRSFKAKSSLQDGDQTILLIPDTPSSSGQQ 119 Query: 176 CDFTSRVSHS 147 T+ S S Sbjct: 120 VKATTSRSFS 129 >06_03_1055 - 27234824-27234838,27236087-27236125,27236322-27237388, 27237422-27237630,27237650-27238053 Length = 577 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = -1 Query: 245 ASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGS 111 A+ A +GK + E E S+QCD T + +S RE ++R+P+ + Sbjct: 430 AAAAAAGKPISEHEAIEHLWSRQCDLTEILQNSSRE-KKRNPYAA 473 >07_03_0846 - 21983581-21986055 Length = 824 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +1 Query: 103 DLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASA 252 DL+D G +R +C+T S PD S VS+ LPD+A+ A A Sbjct: 326 DLQDFTGGCKRNVPLQCQTN--SSSAQTQPDKFYSMVSVRLPDNAQSAVA 373 >01_06_1280 - 35959452-35960105 Length = 217 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -2 Query: 319 HALGRAAGGAKLPSAGLCLNASRPKPA*PNPAR 221 HALG GGA AGLCL +P P P PA+ Sbjct: 90 HALG---GGAGADDAGLCL-GRQPTPPRPQPAK 118 >08_01_0370 + 3275771-3275789,3275972-3276976,3277062-3277624 Length = 528 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 508 RSKSNVAMNAWLPQASYPCGNFSGTLLKTLYTKGSIGRAFAVP 636 +SK + M W S GN SG+LL K G +FA+P Sbjct: 208 KSKRGLIMGIWNAHTSV--GNISGSLLAAFLLKFGWGWSFAIP 248 >08_02_1344 - 26280554-26280785,26281558-26282182,26282718-26284224 Length = 787 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 61 GAVMHVLRKKTDSID----LRDPNGLRRRVSRFECETRLVKSH 177 G V+ L + TDS++ L +P+GL RRV F E+++ H Sbjct: 340 GTVLRYLFQDTDSVNNSGGLLNPSGLLRRVRMFVPESQVTSMH 382 >09_04_0407 + 17345382-17345579,17345711-17346235 Length = 240 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 297 VVRSYHPRDYA*TPQGRSQPSRIRQGYAHCGAP 199 + + YHP+ A +S S IR+ YAHC P Sbjct: 4 LAQEYHPKLPATNHYCKSLSSLIRETYAHCHVP 36 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,773,039 Number of Sequences: 37544 Number of extensions: 393822 Number of successful extensions: 1097 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1097 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -