BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0773 (704 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 9.4 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 9.4 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.0 bits (47), Expect = 9.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 348 RPLTPSTLSHATTTPRVASMSTRFYRT 268 RP T +T TTT A+ +T+F T Sbjct: 109 RPTTTTTTDWITTTTTEATTTTKFPTT 135 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.0 bits (47), Expect = 9.4 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 2/75 (2%) Frame = -3 Query: 642 ISEKARKQPRVLEMIWSSLQFGTVASRNFHCAXKRPRS-KKRPTTGRTRAVPIFAE-DQS 469 I E ARK +VL+ +W + + R + P G +V AE +S Sbjct: 1005 IQEAARKITKVLQQLWREDELQLNLQAHLAALPTRAAAVDAGPLDGEQVSVDGVAELFRS 1064 Query: 468 GAHRPRAQRRG*SRA 424 R R RRG RA Sbjct: 1065 NRGRARRTRRGRRRA 1079 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,215 Number of Sequences: 2352 Number of extensions: 12107 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -