BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0773 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 4.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 4.9 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 8.6 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 586 AIRDGRVAKLPLCXQTTTLQEASHDR 509 A+R GRV K +Q++SH R Sbjct: 137 AVRFGRVPKREKARILAAMQQSSHSR 162 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 4.9 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 362 TSLYSGLLSRRPQPRSRGAQ--CARDHPRRCALGLCAPD*SSAKMGT 496 T L G+LS+ PQ G Q R P +G P ++A M T Sbjct: 188 TRLLHGILSQHPQQHGLGVQNGYGRHLPGHAQMG--RPSYTTATMAT 232 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 8.6 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 Query: 312 WSRGTVCW 335 WS G VCW Sbjct: 822 WSMGIVCW 829 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,313 Number of Sequences: 438 Number of extensions: 3328 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -