BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0772 (749 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit ... 26 5.0 SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra... 25 8.7 SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosa... 25 8.7 >SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit Bgs2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1894 Score = 26.2 bits (55), Expect = 5.0 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +2 Query: 413 INDGCVSWXLW 445 IND CVSW LW Sbjct: 650 INDMCVSWGLW 660 >SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating transcription Rct1|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 25.4 bits (53), Expect = 8.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 597 CRAGNXXGPVTRGGVLVWN 541 C+ G+ GP GG VWN Sbjct: 51 CQTGDPLGPTGDGGRCVWN 69 >SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 25.4 bits (53), Expect = 8.7 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = -2 Query: 742 NGTLPXPAPINPFNWDH----GVPTGPVPMEPLMNLYP 641 N +P PAP++ F+ H +P G VP + YP Sbjct: 470 NAMMPIPAPMDQFSTFHQSMATLPPGAVPTSIPQSYYP 507 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,998,059 Number of Sequences: 5004 Number of extensions: 57900 Number of successful extensions: 104 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -