BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0771 (679 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0477 - 16393764-16394054,16394424-16394672,16394849-163949... 28 7.9 >04_03_0477 - 16393764-16394054,16394424-16394672,16394849-16394989, 16395654-16395795,16396287-16396665,16397178-16397436, 16398232-16398288 Length = 505 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 265 ASLVIRQSHFESTVNDNSNYAVYCXRTSLQRQ 170 + L+I F+ V DN Y V C + Q+Q Sbjct: 299 SKLLINFKEFQDQVTDNEKYMVACTKEEFQKQ 330 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,717,174 Number of Sequences: 37544 Number of extensions: 222147 Number of successful extensions: 452 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -