BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0766 (625 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0107 + 14504065-14504448,14504545-14504922,14506011-145066... 29 2.3 01_03_0145 - 13116302-13116958,13117365-13117430,13117786-131180... 28 6.9 04_01_0579 - 7515242-7516241,7516366-7516393,7516574-7516631 27 9.2 >03_03_0107 + 14504065-14504448,14504545-14504922,14506011-14506619, 14507110-14507237,14507829-14507832 Length = 500 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +3 Query: 402 LIKVFIGHVKQPKDISKLFEILNEKLPLKYLLHLKRSGKR 521 L KVF G KDI +L E+LP++YL KR+G++ Sbjct: 389 LPKVFPGETATTKDIIRLQG--KERLPVEYLPQRKRNGEK 426 >01_03_0145 - 13116302-13116958,13117365-13117430,13117786-13118065, 13118283-13119028 Length = 582 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 282 CHQFCFFSPGFHILSIVFFLHTDF 211 C Q C GFHILS F+ DF Sbjct: 91 CFQVCSKQVGFHILSFKNFISKDF 114 >04_01_0579 - 7515242-7516241,7516366-7516393,7516574-7516631 Length = 361 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 276 DDSINSITIKNQTGIDNLIDSIXNS--KNQPQIILGDE 383 DD +N + T +DN IDS S KN+ I + +E Sbjct: 92 DDEVNEYYTEGVTDVDNYIDSAFRSTRKNKAYIFIREE 129 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,187,069 Number of Sequences: 37544 Number of extensions: 252858 Number of successful extensions: 450 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -