BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0763 (784 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13434| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.52) 31 1.1 SB_34457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_20858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) 28 9.8 >SB_13434| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.52) Length = 835 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 448 ILNSSVGSSLPCGRTTECTSNPQH 519 +LN +G +PCGR T+C SN +H Sbjct: 553 LLNYKIG--VPCGRGTDCVSNAEH 574 >SB_34457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 540 FKYWLYLVLWI*STLCCSP 484 F+ WL L+LW+ S + CSP Sbjct: 149 FRKWLPLLLWLISLIICSP 167 >SB_20858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 317 KL*THHGRKLCQDHLQKLQPRSEAR 391 +L HHGR+L +DHL PR R Sbjct: 199 RLLKHHGRELIKDHLDLPLPRQPKR 223 >SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) Length = 1514 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 Query: 56 SPPARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRAWNMRAKAR 196 +PP+R S R+ SR T S+P T + S RA + R KA+ Sbjct: 1359 APPSRTSTPRSRSTPRSRSRSRTRTPSTPFTPSTTSSRA-SSRGKAK 1404 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,588,523 Number of Sequences: 59808 Number of extensions: 439254 Number of successful extensions: 1098 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1098 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -