BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0760 (656 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosa... 29 0.59 SPCC417.12 |||carboxylesterase-lipase family |Schizosaccharomyce... 27 2.4 SPAC25B8.08 |||conserved fungal family|Schizosaccharomyces pombe... 26 5.5 SPBC4B4.07c |usp102|mud1|U1 snRNP-associated protein Usp102|Schi... 26 5.5 SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ub... 25 7.3 SPCC1682.15 |mug122||PX/PXA domain protein|Schizosaccharomyces p... 25 9.6 >SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1076 Score = 29.1 bits (62), Expect = 0.59 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 266 TDYLDATEEGPVCYQTD-VLYGSLMKPHGMNEACIYANIHVPLYA 397 TD D +++ V TD +LY + PH +Y + H P+YA Sbjct: 800 TDIYDTSDKHRVPAWTDRILYRGELVPHSYQSVPLYYSDHRPIYA 844 >SPCC417.12 |||carboxylesterase-lipase family |Schizosaccharomyces pombe|chr 3|||Manual Length = 520 Score = 27.1 bits (57), Expect = 2.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 192 FRGVPYAKQPVGELRFK 242 F G+ YAK PVG+LR++ Sbjct: 21 FTGIRYAKPPVGKLRWR 37 >SPAC25B8.08 |||conserved fungal family|Schizosaccharomyces pombe|chr 1|||Manual Length = 590 Score = 25.8 bits (54), Expect = 5.5 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -3 Query: 192 NWRIKCLLPPGDYGHTPSLTPSARPHCTTR--AATLLGLNMPLLSPR*RNIVIQRIW 28 +W + P D +P TPSA P T+ A+TL L + + P R I++++ Sbjct: 292 SWNLLRRRPTNDASTSPRSTPSASPRSITKIIASTLHLLEVFYIHPLIRAQCIEQLF 348 >SPBC4B4.07c |usp102|mud1|U1 snRNP-associated protein Usp102|Schizosaccharomyces pombe|chr 2|||Manual Length = 249 Score = 25.8 bits (54), Expect = 5.5 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -3 Query: 582 IQREKSKEIQPVVKSDDNNVSCDKISGPYRSASPDPNAKPPP*IKTNIG 436 +QRE +EI+ K N K + + A+P P K P K N+G Sbjct: 111 VQRESPEEIETRKKDRKNRREMLKRTSALQPAAPKPTHKKPV-PKRNVG 158 >SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ubp21|Schizosaccharomyces pombe|chr 2|||Manual Length = 1129 Score = 25.4 bits (53), Expect = 7.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 162 RAEASTLYASFRGVPYAKQPVGELRFKELQPQSH 263 + + + L A G PY E+ + EL+PQSH Sbjct: 1071 KVKLAVLQAQSFGKPYYLTDDDEVLYGELEPQSH 1104 >SPCC1682.15 |mug122||PX/PXA domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 749 Score = 25.0 bits (52), Expect = 9.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -3 Query: 516 DKISGPYRSASPDPNAKPP 460 D I PYR AS P PP Sbjct: 512 DSIHEPYRPASTQPTENPP 530 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,801,973 Number of Sequences: 5004 Number of extensions: 58890 Number of successful extensions: 138 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -