BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0759 (837 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37217| Best HMM Match : 7tm_1 (HMM E-Value=0.0005) 29 4.7 SB_51468| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_37217| Best HMM Match : 7tm_1 (HMM E-Value=0.0005) Length = 228 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = -1 Query: 411 AVLMKTSKSLA**RTRKTLTASSIWS-SLVWTKVSPRGSMPILYISMNCLTTSNSCTCRN 235 A+ +K S + R T ++IW SLV + +P+ I M + S C + Sbjct: 123 AIYLKNSYLFVVTKKRVFATIAAIWLYSLVTLTYDNKNLLPLYCILMATIIVSLGVVCVS 182 Query: 234 FSRCYTPWR 208 + +C+T R Sbjct: 183 YGKCFTAIR 191 >SB_51468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1626 Score = 28.3 bits (60), Expect = 8.2 Identities = 26/91 (28%), Positives = 44/91 (48%) Frame = -1 Query: 474 KHAAVKA*TNMPPLILSLIQHAVLMKTSKSLA**RTRKTLTASSIWSSLVWTKVSPRGSM 295 K A+V A + +P L + A++ T S + RT+ +ASS +SL T S S Sbjct: 207 KTASVSA-SPVPSSYLQTVSKALVTSTENSTSK-RTKSLSSASSSAASLATTAFSTCSSS 264 Query: 294 PILYISMNCLTTSNSCTCRNFSRCYTPWRSP 202 +I+ + L + NS T + + P ++P Sbjct: 265 GSTFIAAHQLKSGNSGTKKTIN-MLNPGKAP 294 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,117,317 Number of Sequences: 59808 Number of extensions: 493414 Number of successful extensions: 1280 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1278 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2359470773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -