BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0758 (718 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.2 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 6.7 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 6.7 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 22 6.7 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 6.7 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 61 VETKISFSDGSSTDTLRKLSDDLSRKHLSDHSVI 162 + T + S GSS D R LS+ + SD+S + Sbjct: 1312 IATNTTVSSGSSEDHRRPLSEHIYSSIDSDYSTL 1345 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 6.7 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = -2 Query: 582 HPFEYLHWSLW 550 HP+++L W+ W Sbjct: 466 HPYDHLVWNSW 476 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 94 STDTLRKLSDDLSRKHLSDHSVILTEDT 177 S DTLRK++ + L+ +V LT+ T Sbjct: 898 SPDTLRKIAQNRGTNPLAPDAVDLTQLT 925 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +1 Query: 337 FQCPEKRGVFSRLTRLTRVPFAIHTPHDASPV 432 F+C + + LTRL R +HT P+ Sbjct: 3 FRCEPCNKILTSLTRLRRHIQNVHTRPSKEPI 34 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -3 Query: 584 ITRSNISIGRCGN*SIHLTADNTANIPFG 498 + N+ GRC + + +D ANI G Sbjct: 448 VISGNLEKGRCTGKIVTVGSDGNANIEIG 476 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,239 Number of Sequences: 438 Number of extensions: 4600 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -