BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0756 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 2.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 6.1 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 6.1 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 309 DGNIVLASFELPESNIDCV 253 DG+IV F L E + CV Sbjct: 218 DGSIVFVCFSLVEDTLPCV 236 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/38 (23%), Positives = 16/38 (42%) Frame = -1 Query: 672 PRPFWLKAPTCCLRAIQKWARKRQQLGCSQSS*CMRIL 559 P ++ CC A+ RQ + S+ C+R + Sbjct: 605 PHRLAARSRRCCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/38 (23%), Positives = 16/38 (42%) Frame = -1 Query: 672 PRPFWLKAPTCCLRAIQKWARKRQQLGCSQSS*CMRIL 559 P ++ CC A+ RQ + S+ C+R + Sbjct: 497 PHRLAARSRRCCYHAVAPGTDIRQSIALSRKKKCIRYM 534 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,057 Number of Sequences: 336 Number of extensions: 4036 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -